PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004223.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 147aa    MW: 17390.8 Da    PI: 8.4456
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004223.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.6e-5671361128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++   k+   e++ewyfFs++d+ky+tg+r+nrat++g+W
  Itr_sc004223.1_g00002.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRMEPWDIQDrcKLGYeEQSEWYFFSHKDRKYPTGTRTNRATAAGFW 91 
                              69****************************.9***************952433332566*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk+v+sk+++ +g++ktLvfykgrap+g+ktdW+mheyrl
  Itr_sc004223.1_g00002.1  92 KATGRDKAVMSKEEQIIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 136
                              *******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-564141IPR003441NAC domain
PROSITE profilePS5100554.3997147IPR003441NAC domain
PfamPF023651.1E-298136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MEMECCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRMEPW DIQDRCKLGY  60
EEQSEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV MSKEEQIIGM RKTLVFYKGR  120
APNGRKTDWI MHEYRLQTSE HGPPQAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-48213610140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351930.11e-100PREDICTED: NAC domain-containing protein 30
SwissprotQ9C8W96e-88NAC30_ARATH; NAC domain-containing protein 30
TrEMBLM0ZJX91e-100M0ZJX9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000023182e-99(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.14e-78vascular related NAC-domain protein 7